🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

RGN

DescriçãoRegucalcin

Gene and Protein Information

Gene ID9104
Uniprot Accession IDs Q15493 A4FTW1 A8K271 Q53FC9 Q5JRR5 RC
Ensembl ID ENSP00000380365
Symbol SMP30 RC GNL SMP30 HEL-S-41
FamilyBelongs to the SMP-30/CGR1 family.
Sequence
MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp107970955RGNregucalcin9598Inparanoid, EggNOG
Macaque705733RGNregucalcin9544Inparanoid, OMA, EggNOG
Mouse19733Rgnregucalcin10090MGI:108024Inparanoid, OMA, EggNOG
Rat25106Rgnregucalcin10116RGD:3560Inparanoid, OMA, EggNOG
Dog480893RGNregucalcin9615VGNC:45516Inparanoid, OMA, EggNOG
Horse100060684RGNregucalcin9796VGNC:22336OMA, EggNOG
Cow280910RGNregucalcin9913VGNC:33907Inparanoid, OMA, EggNOG
Pig768107RGNregucalcin9823Inparanoid, OMA, EggNOG
Opossum100010821LOC100010821regucalcin-like13616OMA, EggNOG
Chicken395480RGNregucalcin9031CGNC:49339Inparanoid, OMA
Anole lizard100568168rgnregucalcin28377Inparanoid, OMA, EggNOG
Xenopus448549rgnregucalcin8364XB-GENE-483637Inparanoid, OMA, EggNOG
Zebrafish403070rgnregucalcin7955ZDB-GENE-040718-68Inparanoid, OMA
S.cerevisiae852342YBR053Chypothetical protein4932S000000257Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    esterase    /    Regucalcin
protein    /    hydrolase    /    calcium-binding protein    /    Regucalcin
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Esterase    /    Regucalcin

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.