🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

MAPRE1

DescriçãoMicrotubule-associated protein RP/EB family member 1

Gene and Protein Information

Gene ID22919
Uniprot Accession IDs Q15691 B2R6I7 E1P5M8 Q3KQS8
Ensembl ID ENSP00000364721
Symbol EB1
FamilyBelongs to the MAPRE family.
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp746655MAPRE1microtubule associated protein RP/EB family member 19598VGNC:14259OMA, EggNOG
Mouse13589Mapre1microtubule-associated protein, RP/EB family, member 110090MGI:891995Inparanoid, OMA, EggNOG
Rat114764Mapre1microtubule-associated protein, RP/EB family, member 110116RGD:621781Inparanoid, OMA, EggNOG
Dog100685707MAPRE1microtubule associated protein RP/EB family member 19615Inparanoid, OMA, EggNOG
Horse100053947MAPRE1microtubule associated protein RP/EB family member 19796VGNC:19970Inparanoid, OMA, EggNOG
Cow507845MAPRE1microtubule associated protein RP/EB family member 19913VGNC:31232OMA, EggNOG
Pig733687MAPRE1microtubule associated protein RP/EB family member 19823Inparanoid, OMA, EggNOG
Opossum100009758MAPRE1microtubule associated protein RP/EB family member 113616Inparanoid, EggNOG
Chicken419288MAPRE1microtubule associated protein RP/EB family member 19031CGNC:50961Inparanoid, OMA, EggNOG
Anole lizard100551639mapre1microtubule associated protein RP/EB family member 128377Inparanoid, OMA
Xenopus394720mapre1microtubule associated protein RP/EB family member 18364XB-GENE-974542Inparanoid, OMA, EggNOG
Zebrafish334728mapre1bmicrotubule-associated protein, RP/EB family, member 1b7955ZDB-GENE-040426-2256Inparanoid, OMA
S.cerevisiae856736BIM1microtubule-binding protein BIM14932S000000818OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    non-motor microtubule binding protein    /    Microtubule-associated protein RP/EB family member 1
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Non-motor microtubule binding protein    /    Microtubule-associated protein RP/EB family member 1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.