🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

MMP16

DescriçãoMatrix metalloproteinase-16

Gene and Protein Information

Gene ID4325
Uniprot Accession IDs P51512 B2RAN7 Q14824 Q52H48 MMP-16
Ensembl ID ENSP00000286614
Symbol C8orf57 MMPX2 MMP-X2 C8orf57 MT-MMP2 MT-MMP3 MT3-MMP
FamilyBelongs to the peptidase M10A family.
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp736322MMP16matrix metallopeptidase 169598VGNC:6570OMA, EggNOG
Macaque695120MMP16matrix metallopeptidase 169544Inparanoid, OMA, EggNOG
Mouse17389Mmp16matrix metallopeptidase 1610090MGI:1276107Inparanoid, OMA, EggNOG
Rat65205Mmp16matrix metallopeptidase 1610116RGD:620199Inparanoid, OMA, EggNOG
Dog487036MMP16matrix metallopeptidase 169615VGNC:43278Inparanoid, OMA
Horse100049862MMP16matrix metallopeptidase 169796VGNC:20226Inparanoid, OMA, EggNOG
Cow282886MMP16matrix metallopeptidase 169913VGNC:31521Inparanoid, OMA, EggNOG
Pig100153257MMP16matrix metallopeptidase 169823Inparanoid, OMA, EggNOG
Opossum100021706MMP16matrix metallopeptidase 1613616Inparanoid, OMA
Platypus100075102MMP16matrix metallopeptidase 169258Inparanoid, OMA, EggNOG
Anole lizard100551730mmp16matrix metallopeptidase 1628377Inparanoid, OMA, EggNOG
Xenopus548746mmp16matrix metallopeptidase 168364XB-GENE-1007177Inparanoid, OMA
Zebrafish572034mmp16bmatrix metallopeptidase 16b (membrane-inserted)7955ZDB-GENE-061009-22Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.