LGALS4

DescriçãoGalectin-4

Gene and Protein Information

Gene ID3960
Uniprot Accession IDs P56470 Gal-4
Ensembl ID ENSP00000302100
Symbol GAL4 L36LBP
Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp456011LGALS4galectin 49598VGNC:10392OMA, EggNOG
Macaque694195LGALS4galectin 49544Inparanoid, OMA, EggNOG
Mouse16855Lgals4lectin, galactose binding, soluble 410090MGI:107536OMA, EggNOG
Rat25474Lgals4galectin 410116RGD:3003Inparanoid, OMA, EggNOG
Dog484521LGALS4galectin 49615VGNC:42649Inparanoid, OMA, EggNOG
Horse100064337LGALS4galectin 49796VGNC:19643Inparanoid, OMA, EggNOG
Cow614804LGALS4galectin 49913VGNC:30854Inparanoid, OMA, EggNOG
Pig397041LGALS4galectin 49823Inparanoid, EggNOG
Opossum100011146LGALS4galectin 413616Inparanoid, OMA, EggNOG
Anole lizard100567030lgals4galectin 428377Inparanoid, OMA, EggNOG
Xenopus496937lgals4.1lectin, galactoside-binding, soluble, 4, gene 18364XB-GENE-992854OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.