🌎 Enviar para: United States
Alternar navegação
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

MAP1LC3A

DescriçãoMicrotubule-associated proteins 1A/1B light chain 3A

Gene and Protein Information

Gene ID84557
Uniprot Accession IDs Q9H492 E1P5P4 E1P5P5 Q9BXW5
Ensembl ID ENSP00000363970
Symbol LC3 LC3A ATG8E MAP1ALC3 MAP1BLC3
FamilyBelongs to the ATG8 family.
Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp744937MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9598VGNC:14258OMA, EggNOG
Mouse66734Map1lc3amicrotubule-associated protein 1 light chain 3 alpha10090MGI:1915661Inparanoid, OMA, EggNOG
Rat362245Map1lc3amicrotubule-associated protein 1 light chain 3 alpha10116RGD:735183Inparanoid, OMA
Dog477201MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9615VGNC:54324Inparanoid, OMA, EggNOG
Horse100146217MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9796VGNC:19923Inparanoid, OMA, EggNOG
Cow514547MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9913VGNC:31179Inparanoid, OMA, EggNOG
Pig100322893MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9823Inparanoid, OMA, EggNOG
Opossum100028493MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha13616Inparanoid, EggNOG
PlatypusMAP1LC3Amicrotubule associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:HGNC:6838]9258OMA, EggNOG
Anole lizard100563996map1lc3amicrotubule associated protein 1 light chain 3 alpha28377Inparanoid, OMA, EggNOG
Xenopus493344map1lc3amicrotubule associated protein 1 light chain 3 alpha8364XB-GENE-941851Inparanoid, OMA, EggNOG
Zebrafish406466map1lc3amicrotubule-associated protein 1 light chain 3 alpha7955ZDB-GENE-040426-2232Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    non-motor microtubule binding protein    /    Microtubule-associated proteins 1A/1B light chain 3A
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Non-motor microtubule binding protein    /    Microtubule-associated proteins 1A/1B light chain 3A

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.