MPC1L

DescriçãoMitochondrial pyruvate carrier 1-like protein

Gene and Protein Information

Gene ID347411
Uniprot Accession IDs P0DKB6
Symbol SLC54A3
FamilyBelongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family.
Sequence
MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
S.cerevisiae852800MPC1pyruvate transporter MPC14932S000003048Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC54 Mitochondrial pyruvate carriers    /    Mitochondrial pyruvate carrier 1-like protein

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.