CA4

DescriçãoCarbonic anhydrase 4

Gene and Protein Information

Gene ID762
Uniprot Accession IDs P22748 B4DQA4 Q6FHI7
Ensembl ID ENSP00000300900
Symbol CAIV Car4 RP17
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp454807CA4carbonic anhydrase 49598VGNC:9136OMA, EggNOG
Mouse12351Car4carbonic anhydrase 410090MGI:1096574Inparanoid, OMA, EggNOG
Rat29242Car4carbonic anhydrase 410116RGD:2242OMA, EggNOG
Dog480591CA4carbonic anhydrase 49615VGNC:38612Inparanoid, OMA, EggNOG
Horse100071384CA4carbonic anhydrase 49796VGNC:15965Inparanoid, OMA, EggNOG
Cow280741CA4carbonic anhydrase 49913VGNC:26654Inparanoid, OMA, EggNOG
Pig100511956CA4carbonic anhydrase 49823Inparanoid, OMA, EggNOG
Chicken417647CA4carbonic anhydrase 49031CGNC:3991Inparanoid, OMA, EggNOG
Anole lizard103280438ca4carbonic anhydrase 428377Inparanoid, OMA, EggNOG
Xenopus100489625ca4carbonic anhydrase IV8364XB-GENE-5952677OMA, EggNOG
Zebrafish555196ca4acarbonic anhydrase IV a7955ZDB-GENE-080204-85OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.