BCL2

DescriçãoApoptosis regulator Bcl-2

Gene and Protein Information

Gene ID596
Uniprot Accession IDs P10415 C9JHD5 P10416 Q13842 Q16197
Ensembl ID ENSP00000381185
Symbol Bcl-2 PPP1R50
FamilyBelongs to the Bcl-2 family.
Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Mouse12043Bcl2B cell leukemia/lymphoma 210090MGI:88138Inparanoid, OMA, EggNOG
Rat24224Bcl2BCL2, apoptosis regulator10116RGD:2199Inparanoid, OMA, EggNOG
Dog403416BCL2BCL2, apoptosis regulator9615VGNC:54274Inparanoid, OMA, EggNOG
Horse100050934BCL2BCL2, apoptosis regulator9796VGNC:15790Inparanoid, OMA, EggNOG
Cow281020BCL2BCL2, apoptosis regulator9913VGNC:26445Inparanoid, OMA, EggNOG
Opossum100016570BCL2BCL2, apoptosis regulator13616Inparanoid, OMA, EggNOG
Chicken396282BCL2BCL2, apoptosis regulator9031CGNC:9759Inparanoid, OMA, EggNOG
Anole lizard100564886LOC100564886apoptosis regulator Bcl-228377Inparanoid, OMA, EggNOG
Xenopus100485267bcl2B-cell CLL/lymphoma 28364XB-GENE-943008Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.