🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

BDNF

DescriçãoBrain-derived neurotrophic factor

Gene and Protein Information

Gene ID627
Uniprot Accession IDs P23560 A7LA85 A7LA92 D3DQZ2 Q598Q1 Q6DN19 Q6YNR2 Q6YNR3 Q9BYY7 Q9UC24 BDNF
Ensembl ID ENSP00000414303
Symbol ANON2 BULN2
FamilyBelongs to the NGF-beta family.
Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp503511BDNFbrain derived neurotrophic factor9598VGNC:11265Inparanoid, OMA
Macaque701245BDNFbrain derived neurotrophic factor9544OMA, EggNOG
Mouse12064Bdnfbrain derived neurotrophic factor10090MGI:88145Inparanoid, OMA, EggNOG
Rat24225Bdnfbrain-derived neurotrophic factor10116RGD:2202Inparanoid, OMA, EggNOG
DogBDNFbrain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033]9615OMA, EggNOG
Horse100009689BDNFbrain derived neurotrophic factor9796Inparanoid, OMA, EggNOG
Cow617701BDNFbrain derived neurotrophic factor9913VGNC:26461Inparanoid, OMA, EggNOG
Pig397495BDNFbrain derived neurotrophic factor9823Inparanoid, OMA, EggNOG
OpossumBDNFbrain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033]13616Inparanoid, OMA, EggNOG
Chicken396186BDNFbrain derived neurotrophic factor9031CGNC:9230Inparanoid, OMA, EggNOG
Anole lizard100564408bdnfbrain derived neurotrophic factor28377Inparanoid, OMA, EggNOG
Xenopus100037853bdnfbrain-derived neurotrophic factor8364XB-GENE-955554Inparanoid, OMA, EggNOG
Zebrafish58118bdnfbrain-derived neurotrophic factor7955ZDB-GENE-000412-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    growth factor    /    neurotrophic factor    /    Brain-derived neurotrophic factor
DTO Classes
protein    /    Signaling    /    Growth factor    /    Neurotrophic factor    /    Brain-derived neurotrophic factor

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.