🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SLC7A11

DescriçãoCystine/glutamate transporter

Gene and Protein Information

Gene ID23657
Uniprot Accession IDs Q9UPY5 A8K2U4
Ensembl ID ENSP00000280612
Symbol xCT CCBR1
FamilyBelongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp471310SLC7A11solute carrier family 7 member 119598VGNC:50362OMA, EggNOG
Macaque696516SLC7A11solute carrier family 7 member 119544Inparanoid, OMA, EggNOG
Mouse26570Slc7a11solute carrier family 7 (cationic amino acid transporter, y+ system), member 1110090MGI:1347355Inparanoid, OMA, EggNOG
Rat310392Slc7a11solute carrier family 7 member 1110116RGD:1309275Inparanoid, OMA, EggNOG
Dog483821SLC7A11solute carrier family 7 member 119615VGNC:46472Inparanoid, OMA, EggNOG
Horse100063433SLC7A11solute carrier family 7 member 119796VGNC:23267Inparanoid, OMA, EggNOG
Cow524078SLC7A11solute carrier family 7 member 119913VGNC:34926Inparanoid, OMA, EggNOG
Opossum100027770SLC7A11solute carrier family 7 member 1113616Inparanoid, OMA, EggNOG
Chicken428731SLC7A11solute carrier family 7 member 119031CGNC:7416Inparanoid, OMA, EggNOG
Xenopusslc7a11solute carrier family 7 member 11 [Source:Xenbase;Acc:XB-GENE-960114]8364OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC3 and SLC7 families of heteromeric amino acid transporters (HATs)    /    SLC7 family    /    Cystine/glutamate transporter

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.