🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PFKFB2

Descrição6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2

Gene and Protein Information

Gene ID5208
Uniprot Accession IDs O60825 O60824 Q5VVQ3 Q5VVQ4 Q9H3P1 6PF-2-K/Fru-2,6-P2ase 2
Ensembl ID ENSP00000356047
Symbol PFK-2/FBPase-2
FamilyIn the C-terminal section; belongs to the phosphoglycerate mutase family.
Sequence
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp457687PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29598VGNC:8091OMA, EggNOG
Macaque693509PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29544Inparanoid, OMA, EggNOG
Mouse18640Pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 210090MGI:107815Inparanoid, OMA, EggNOG
Rat24640Pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 210116RGD:3309Inparanoid, OMA, EggNOG
Dog480011PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29615VGNC:44443Inparanoid, OMA
Horse100051146PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29796VGNC:21338Inparanoid, OMA
Cow287019PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29913VGNC:32770Inparanoid, OMA
Opossum100020159PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 213616Inparanoid, OMA
Chicken419850PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29031CGNC:758Inparanoid, OMA
Anole lizard100563872pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 228377Inparanoid, OMA
Xenopus100170160pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 28364XB-GENE-981174Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.