GJB4

DescriçãoGap junction beta-4 protein

Gene and Protein Information

Gene ID127534
Uniprot Accession IDs Q9NTQ9 B3KQ82
Ensembl ID ENSP00000345868
Symbol EKV EKVP2 CX30.3
FamilyBelongs to the connexin family. Beta-type (group I) subfamily.
Sequence
MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp469272GJB4gap junction protein beta 49598VGNC:11439OMA, EggNOG
Macaque710994GJB4gap junction protein beta 49544Inparanoid, OMA, EggNOG
Mouse14621Gjb4gap junction protein, beta 410090MGI:95722Inparanoid, OMA, EggNOG
Rat117055Gjb4gap junction protein, beta 410116RGD:621829Inparanoid, OMA, EggNOG
Dog482487GJB4gap junction protein beta 49615VGNC:41240Inparanoid, OMA, EggNOG
Horse100069762GJB4gap junction protein beta 49796VGNC:18357Inparanoid, OMA, EggNOG
Cow100140553GJB4gap junction protein beta 49913VGNC:29379Inparanoid, OMA, EggNOG
Opossum100031157GJB4gap junction protein beta 413616Inparanoid, OMA, EggNOG
Platypus100076681GJB4gap junction protein beta 49258Inparanoid, OMA, EggNOG
Zebrafish404727cx34.4connexin 34.47955ZDB-GENE-040406-3Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction beta-4 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction beta-4 protein

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.