🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SUB1

DescriçãoActivated RNA polymerase II transcriptional coactivator p15

Gene and Protein Information

Gene ID10923
Uniprot Accession IDs P53999 Q96L29
Ensembl ID ENSP00000265073
Symbol PC4 RPO2TC1 P15 PC4 p14
FamilyBelongs to the transcriptional coactivator PC4 family.
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Mouse20024Sub1SUB1 homolog (S. cerevisiae)10090MGI:104811Inparanoid, OMA, EggNOG
Rat192269Sub1SUB1 homolog, transcriptional regulator10116RGD:621582Inparanoid, OMA, EggNOG
Dog479283SUB1SUB1 homolog, transcriptional regulator9615OMA, EggNOG
Horse100068496SUB1SUB1 homolog, transcriptional regulator9796VGNC:23741Inparanoid, OMA, EggNOG
Cow533984SUB1SUB1 homolog, transcriptional regulator9913VGNC:35454Inparanoid, OMA, EggNOG
Opossum100015659SUB1SUB1 homolog, transcriptional regulator13616Inparanoid, OMA, EggNOG
Platypus100092955SUB1SUB1 homolog, transcriptional regulator9258Inparanoid, OMA, EggNOG
Chicken427425SUB1SUB1 homolog, transcriptional regulator9031CGNC:2359Inparanoid, OMA, EggNOG
Anole lizard100563239sub1SUB1 homolog, transcriptional regulator28377Inparanoid, OMA, EggNOG
Xenopus448190sub1SUB1 homolog, transcriptional regulator8364XB-GENE-1015843Inparanoid, OMA, EggNOG
Zebrafish553561sub1aSUB1 homolog, transcriptional regulator a7955ZDB-GENE-050522-151Inparanoid, OMA
C. elegans188475T13F2.2Putative RNA polymerase II transcriptional coactivator6239Inparanoid, OMA
Fruitfly34120Ssb-c31aSingle stranded-binding protein c31A7227FBgn0015299Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.