🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

TIA1

DescriçãoNucleolysin TIA-1 isoform p40

Gene and Protein Information

Gene ID7072
Uniprot Accession IDs P31483 Q53SS9 Q96B58
Ensembl ID ENSP00000401371
Symbol WDM TIA-1
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp459303TIA1TIA1 cytotoxic granule associated RNA binding protein9598OMA, EggNOG
Macaque702366TIA1TIA1 cytotoxic granule associated RNA binding protein9544Inparanoid, OMA, EggNOG
Mouse21841Tia1cytotoxic granule-associated RNA binding protein 110090MGI:107914Inparanoid, OMA, EggNOG
Rat312510Tia1TIA1 cytotoxic granule-associated RNA binding protein10116RGD:1305742Inparanoid, OMA
Dog610625TIA1TIA1 cytotoxic granule associated RNA binding protein9615VGNC:47363Inparanoid, OMA, EggNOG
HorseTIA1TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802]9796OMA, EggNOG
Cow538533TIA1TIA1 cytotoxic granule associated RNA binding protein9913VGNC:35858Inparanoid, OMA, EggNOG
Opossum100032808TIA1TIA1 cytotoxic granule associated RNA binding protein13616Inparanoid, EggNOG
Chicken771327TIA1TIA1 cytotoxic granule associated RNA binding protein9031Inparanoid, OMA, EggNOG
Xenopus394890tia1TIA1 cytotoxic granule-associated RNA binding protein8364XB-GENE-1002876Inparanoid, OMA, EggNOG
Zebrafish793165tia1TIA1 cytotoxic granule-associated RNA binding protein7955ZDB-GENE-030131-1506Inparanoid, OMA, EggNOG
C. elegans173967tiar-1TIA-1/TIAL RNA binding protein homolog6239OMA, EggNOG
S.cerevisiae855716PUB1Pub1p4932S000004961OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.