CLDN6

DescriçãoClaudin-6

Gene and Protein Information

Gene ID9074
Uniprot Accession IDs P56747 B3KQP9 D3DUA5
Ensembl ID ENSP00000380131
FamilyBelongs to the claudin family.
Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque699854CLDN6claudin 69544Inparanoid, OMA, EggNOG
Mouse54419Cldn6claudin 610090MGI:1859284Inparanoid, OMA, EggNOG
Rat287098Cldn6claudin 610116RGD:1308837Inparanoid, OMA, EggNOG
Dog490048CLDN6claudin 69615VGNC:39322Inparanoid, OMA, EggNOG
Cow511318CLDN6claudin 69913VGNC:27418Inparanoid, OMA, EggNOG
Pig100302020CLDN6claudin 69823Inparanoid, OMA, EggNOG
Opossum100014960CLDN6claudin 613616Inparanoid, OMA, EggNOG
Anole lizard100562099LOC100562099claudin-428377Inparanoid, OMA
Xenopus100493413cldn6.2claudin 6, gene 28364XB-GENE-1009648Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    tight junction    /    Claudin-6
DTO Classes
protein    /    Cell-cell junction    /    Tight junction    /    Claudin-6

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.