🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

ATF3

DescriçãoCyclic AMP-dependent transcription factor ATF-3

Gene and Protein Information

Gene ID467
Uniprot Accession IDs P18847 Q5VTZ2 Q6ICQ9 Q7Z566 Q8WYM6 cAMP-dependent transcription factor ATF-3
Ensembl ID ENSP00000344352
FamilyBelongs to the bZIP family. ATF subfamily.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp469143ATF3activating transcription factor 39598VGNC:10546OMA, EggNOG
Macaque710832ATF3activating transcription factor 39544Inparanoid, OMA, EggNOG
Mouse11910Atf3activating transcription factor 310090MGI:109384Inparanoid, OMA, EggNOG
Rat25389Atf3activating transcription factor 310116RGD:2165Inparanoid, OMA, EggNOG
Dog612911ATF3activating transcription factor 39615VGNC:38209Inparanoid, OMA, EggNOG
Horse100050849ATF3activating transcription factor 39796VGNC:15611Inparanoid, OMA, EggNOG
Cow515266ATF3activating transcription factor 39913VGNC:26241Inparanoid, OMA, EggNOG
Pig100738612ATF3activating transcription factor 39823OMA, EggNOG
Opossum100016599ATF3activating transcription factor 313616Inparanoid, OMA, EggNOG
Platypus100075947ATF3activating transcription factor 39258Inparanoid, OMA, EggNOG
Chicken421369ATF3activating transcription factor 39031CGNC:66403Inparanoid, OMA
Anole lizard100566474atf3activating transcription factor 328377Inparanoid, OMA, EggNOG
Xenopus100494437atf3activating transcription factor 38364XB-GENE-6085251Inparanoid, OMA, EggNOG
Zebrafish393939atf3activating transcription factor 37955ZDB-GENE-040426-728Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.