KCTD8

DescriçãoBTB/POZ domain-containing protein KCTD8

Gene and Protein Information

Gene ID386617
Uniprot Accession IDs Q6ZWB6 A2RU39
Ensembl ID ENSP00000353129
Sequence
MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp461195KCTD8potassium channel tetramerization domain containing 89598VGNC:13099OMA, EggNOG
Macaque703107KCTD8potassium channel tetramerization domain containing 89544Inparanoid, OMA, EggNOG
Mouse243043Kctd8potassium channel tetramerisation domain containing 810090MGI:2443804Inparanoid, OMA, EggNOG
Dog610705KCTD8potassium channel tetramerization domain containing 89615VGNC:42311Inparanoid, OMA
OpossumKCTD8potassium channel tetramerization domain containing 8 [Source:HGNC Symbol;Acc:HGNC:22394]13616Inparanoid, OMA
Chicken770600KCTD8potassium channel tetramerization domain containing 89031CGNC:10600Inparanoid, OMA
Anole lizard100562362kctd8potassium channel tetramerization domain containing 828377Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.