GOLM1

DescriçãoGolgi membrane protein 1

Gene and Protein Information

Gene ID51280
Uniprot Accession IDs Q8NBJ4 Q6IAF4 Q9NRB9
Ensembl ID ENSP00000373364
Symbol C9orf155 GOLPH2 GP73 HEL46 GOLPH2 C9orf155 PSEC0257 bA379P1.3
FamilyBelongs to the GOLM1/CASC4 family.
Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp464562GOLM1golgi membrane protein 19598VGNC:13888OMA, EggNOG
Macaque715029GOLM1golgi membrane protein 19544OMA, EggNOG
Mouse105348Golm1golgi membrane protein 110090MGI:1917329Inparanoid, OMA, EggNOG
Rat680692Golm1golgi membrane protein 110116RGD:1589384Inparanoid, OMA, EggNOG
Dog476303GOLM1golgi membrane protein 19615VGNC:41345Inparanoid, OMA, EggNOG
HorseGOLM1golgi membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:15451]9796OMA, EggNOG
Cow517052GOLM1golgi membrane protein 19913VGNC:29491Inparanoid, OMA, EggNOG
Pig100517183GOLM1golgi membrane protein 19823OMA, EggNOG
Opossum100029161GOLM1golgi membrane protein 113616Inparanoid, OMA, EggNOG
Chicken427462GOLM1golgi membrane protein 19031CGNC:9562Inparanoid, EggNOG
Anole lizard100557871golm1golgi membrane protein 128377Inparanoid, OMA
Xenopus779448golm1golgi membrane protein 18364XB-GENE-1002584Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.