🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

KCNK9

DescriçãoPotassium channel subfamily K member 9

Gene and Protein Information

Gene ID51305
Uniprot Accession IDs Q9NPC2 Q2M290 Q540F2
Ensembl ID ENSP00000430676
Symbol TASK3 KT3.2 TASK3 K2p9.1 TASK-3
FamilyBelongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque100425983KCNK9potassium two pore domain channel subfamily K member 99544Inparanoid, OMA, EggNOG
Mouse223604Kcnk9potassium channel, subfamily K, member 910090MGI:3521816Inparanoid, OMA, EggNOG
Rat84429Kcnk9potassium two pore domain channel subfamily K member 910116RGD:621451Inparanoid, OMA, EggNOG
Dog482057KCNK9potassium two pore domain channel subfamily K member 99615VGNC:42280Inparanoid, OMA
Horse100058202KCNK9potassium two pore domain channel subfamily K member 99796VGNC:19302Inparanoid, OMA
Cow539586KCNK9potassium two pore domain channel subfamily K member 99913VGNC:30478Inparanoid, OMA
Opossum100027125KCNK9potassium two pore domain channel subfamily K member 913616Inparanoid, OMA
Anole lizard100555658kcnk9potassium two pore domain channel subfamily K member 928377Inparanoid, OMA
Zebrafish799704kcnk9potassium channel, subfamily K, member 97955ZDB-GENE-070705-260Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Two pore domain potassium channel family    /    Potassium channel subfamily K member 9

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.