GSTM1

DescriçãoGlutathione S-transferase Mu 1

Gene and Protein Information

Gene ID2944
Uniprot Accession IDs P09488 Q5GHG0 Q6FH88 Q8TC98 Q9UC96
Ensembl ID ENSP00000311469
Symbol GST1 MU H-B GST1 GTH4 GTM1 MU-1 GSTM1-1 GSTM1a-1a GSTM1b-1b
FamilyBelongs to the GST superfamily. Mu family.
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp745723GSTM1glutathione S-transferase mu 19598VGNC:14256OMA, EggNOG
MacaqueGSTM1glutathione S-transferase mu 1 [Source:HGNC Symbol;Acc:HGNC:4632]9544Inparanoid, OMA
Mouse14863Gstm2glutathione S-transferase, mu 210090MGI:95861Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.