224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Glutathione S-transferase Mu 1 |
|---|
Gene and Protein Information
| Gene ID | 2944 |
|---|---|
| Uniprot Accession IDs | P09488 Q5GHG0 Q6FH88 Q8TC98 Q9UC96 |
| Ensembl ID | ENSP00000311469 |
| Symbol | GST1 MU H-B GST1 GTH4 GTM1 MU-1 GSTM1-1 GSTM1a-1a GSTM1b-1b |
| Family | Belongs to the GST superfamily. Mu family. |
| Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745723 | GSTM1 | glutathione S-transferase mu 1 | 9598 | VGNC:14256 | OMA, EggNOG |
| Macaque | GSTM1 | glutathione S-transferase mu 1 [Source:HGNC Symbol;Acc:HGNC:4632] | 9544 | Inparanoid, OMA | ||
| Mouse | 14863 | Gstm2 | glutathione S-transferase, mu 2 | 10090 | MGI:95861 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.