🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PAX8

DescriçãoPaired box protein Pax-8

Gene and Protein Information

Gene ID7849
Uniprot Accession IDs Q06710 Q09155 Q16337 Q16338 Q16339 Q4ZG35 Q96J49
Ensembl ID ENSP00000263334
Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp459503PAX8paired box 89598VGNC:10736OMA, EggNOG
Macaque701906PAX8paired box 89544Inparanoid, OMA, EggNOG
Mouse18510Pax8paired box 810090MGI:97492Inparanoid, OMA, EggNOG
Rat81819Pax8paired box 810116RGD:620434Inparanoid, OMA, EggNOG
Dog403927PAX8paired box 89615VGNC:44279Inparanoid, OMA, EggNOG
Horse100065303PAX8paired box 89796VGNC:21178Inparanoid, OMA, EggNOG
Cow534661PAX8paired box 89913VGNC:32599Inparanoid, OMA, EggNOG
Opossum100026381PAX8paired box 813616Inparanoid, EggNOG
PlatypusPAX8paired box 8 [Source:HGNC Symbol;Acc:HGNC:8622]9258OMA, EggNOG
Xenopus780226pax8paired box 88364XB-GENE-483693Inparanoid, OMA
Zebrafish60637pax8paired box 87955ZDB-GENE-001030-3Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.