🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

OXGR1

Descrição2-oxoglutarate receptor 1

Gene and Protein Information

Gene ID27199
Uniprot Accession IDs Q96P68 Q5T5A7 Q86TL1
Ensembl ID ENSP00000298440
Symbol GPR80 GPR99 P2RY15 P2Y15 aKGR GPR80 GPR99 P2Y15 P2RY15
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque696735OXGR1oxoglutarate receptor 19544Inparanoid, OMA, EggNOG
Mouse239283Oxgr1oxoglutarate (alpha-ketoglutarate) receptor 110090MGI:2685145Inparanoid, OMA, EggNOG
Rat290493Oxgr1oxoglutarate receptor 110116RGD:1303155Inparanoid, OMA, EggNOG
DogOXGR1oxoglutarate receptor 1 [Source:HGNC Symbol;Acc:HGNC:4531]9615OMA, EggNOG
Horse100060024OXGR1oxoglutarate receptor 19796VGNC:21100Inparanoid, OMA, EggNOG
Cow539318OXGR1oxoglutarate receptor 19913VGNC:32510Inparanoid, OMA, EggNOG
Pig100626102OXGR1oxoglutarate receptor 19823OMA, EggNOG
Opossum100026790OXGR1oxoglutarate receptor 113616Inparanoid, OMA, EggNOG
Chicken428023OXGR1oxoglutarate receptor 19031CGNC:53243Inparanoid, OMA
Zebrafishoxgr1boxoglutarate (alpha-ketoglutarate) receptor 1b7955ZDB-GENE-070912-324Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    2-oxoglutarate receptor 1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.