🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PTF1A

DescriçãoPancreas transcription factor 1 subunit alpha

Gene and Protein Information

Gene ID256297
Uniprot Accession IDs Q7RTS3 Q9HC25
Ensembl ID ENSP00000365687
Symbol BHLHA29 PTF1P48 p48 PACA PAGEN2 bHLHa29 PTF1-p48
Sequence
MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Mouse19213Ptf1apancreas specific transcription factor, 1a10090MGI:1328312Inparanoid, OMA, EggNOG
Rat117034Ptf1apancreas associated transcription factor 1a10116RGD:621709Inparanoid, OMA, EggNOG
Dog608313PTF1Apancreas associated transcription factor 1a9615VGNC:52912Inparanoid, OMA, EggNOG
HorsePTF1Apancreas specific transcription factor, 1a [Source:HGNC Symbol;Acc:HGNC:23734]9796OMA, EggNOG
Cow781540PTF1Apancreas associated transcription factor 1a9913VGNC:33498Inparanoid, OMA, EggNOG
Pig100623168PTF1Apancreas specific transcription factor, 1a9823OMA, EggNOG
Opossum100019635PTF1Apancreas specific transcription factor, 1a13616Inparanoid, OMA, EggNOG
Anole lizard100567005ptf1apancreas specific transcription factor, 1a28377Inparanoid, OMA, EggNOG
Xenopus100494161ptf1apancreas associated transcription factor 1a8364XB-GENE-484425Inparanoid, OMA, EggNOG
Zebrafish368662ptf1apancreas associated transcription factor 1a7955ZDB-GENE-030616-579Inparanoid, OMA, EggNOG
Fruitfly2768661Fer148 related 17227FBgn0037475Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.