🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

P2RY13

DescriçãoP2Y purinoceptor 13

Gene and Protein Information

Gene ID53829
Uniprot Accession IDs Q9BPV8 B2R827 Q05C50 Q6DKN4 Q8IUT5 Q8TDU7 Q9BY61 P2Y13
Ensembl ID ENSP00000320376
Symbol GPR86 GPR94 GPCR1 GPR86 GPR94 P2Y13 SP174 FKSG77
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp738859P2RY13purinergic receptor P2Y139598VGNC:7992OMA, EggNOG
Mouse74191P2ry13purinergic receptor P2Y, G-protein coupled 1310090MGI:1921441Inparanoid, OMA, EggNOG
Rat310444P2ry13purinergic receptor P2Y1310116RGD:1302941Inparanoid, OMA, EggNOG
Dog102155830P2RY13purinergic receptor P2Y139615VGNC:44215Inparanoid, OMA, EggNOG
Horse100050217P2RY13purinergic receptor P2Y139796VGNC:21111Inparanoid, OMA, EggNOG
Cow782774P2RY13purinergic receptor P2Y139913VGNC:32526Inparanoid, OMA, EggNOG
Opossum103104547P2RY13purinergic receptor P2Y1313616Inparanoid, OMA, EggNOG
Anole lizard103278183p2ry13purinergic receptor P2Y1328377Inparanoid, OMA
Xenopus548413p2ry13purinergic receptor P2Y, G-protein coupled, 138364XB-GENE-5807786Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    P2Y purinoceptor 13
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2Y purinoceptor 13

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.