🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PPP1CC

DescriçãoSerine/threonine-protein phosphatase PP1-gamma catalytic subunit

Gene and Protein Information

Gene ID5501
Uniprot Accession IDs P36873 PP-1G
Ensembl ID ENSP00000341779
Symbol PP1C PP-1G PPP1G
FamilyBelongs to the PPP phosphatase family. PP-1 subfamily.
Sequence
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque709935PPP1CCprotein phosphatase 1 catalytic subunit gamma9544Inparanoid, OMA
Mouse19047Ppp1ccprotein phosphatase 1, catalytic subunit, gamma isoform10090MGI:104872Inparanoid, OMA, EggNOG
Rat24669Ppp1ccprotein phosphatase 1 catalytic subunit gamma10116RGD:3377Inparanoid, OMA, EggNOG
Dog403557PPP1CCprotein phosphatase 1 catalytic subunit gamma9615VGNC:52957Inparanoid, OMA, EggNOG
Horse100058160PPP1CCprotein phosphatase 1 catalytic subunit gamma9796VGNC:50962Inparanoid, OMA
Cow282318PPP1CCprotein phosphatase 1 catalytic subunit gamma9913VGNC:53916Inparanoid, OMA, EggNOG
Opossum100019898PPP1CCprotein phosphatase 1 catalytic subunit gamma13616Inparanoid, OMA, EggNOG
Chicken416872PPP1CCprotein phosphatase 1 catalytic subunit gamma9031CGNC:50363OMA, EggNOG
Anole lizard100565990ppp1ccprotein phosphatase 1 catalytic subunit gamma28377Inparanoid, OMA
Xenopus407879ppp1ccprotein phosphatase 1, catalytic subunit, gamma isozyme8364XB-GENE-967934Inparanoid, OMA, EggNOG
Zebrafish571753ppp1ccprotein phosphatase 1, catalytic subunit, gamma isozyme7955ZDB-GENE-030131-5877Inparanoid, OMA
Fruitfly49260Pp1-87BProtein phosphatase 1 at 87B7227FBgn0004103OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.