🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Sodium/bile acid cotransporter |
|---|
Gene and Protein Information
| Gene ID | 6554 |
|---|---|
| Uniprot Accession IDs | Q14973 B9EGB6 Q2TU29 |
| Ensembl ID | ENSP00000216540 |
| Symbol | NTCP NTCP |
| Family | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. |
| Sequence | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453001 | SLC10A1 | solute carrier family 10 member 1 | 9598 | VGNC:8206 | OMA, EggNOG |
| Macaque | 712925 | SLC10A1 | solute carrier family 10 member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20493 | Slc10a1 | solute carrier family 10 (sodium/bile acid cotransporter family), member 1 | 10090 | MGI:97379 | Inparanoid, OMA, EggNOG |
| Rat | 24777 | Slc10a1 | solute carrier family 10 member 1 | 10116 | RGD:3681 | Inparanoid, OMA, EggNOG |
| Dog | 480372 | SLC10A1 | solute carrier family 10 member 1 | 9615 | VGNC:46211 | Inparanoid, OMA, EggNOG |
| Horse | 100064290 | SLC10A1 | solute carrier family 10 member 1 | 9796 | VGNC:23011 | Inparanoid, OMA, EggNOG |
| Cow | 532890 | SLC10A1 | solute carrier family 10 member 1 | 9913 | VGNC:34659 | Inparanoid, OMA, EggNOG |
| Pig | 100153302 | SLC10A1 | solute carrier family 10 member 1 | 9823 | OMA, EggNOG | |
| Opossum | 100028851 | SLC10A1 | solute carrier family 10 member 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | SLC10A1 | solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | SLC10A1 | solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905] | 8364 | OMA, EggNOG | ||
| Zebrafish | 562260 | slc10a1 | solute carrier family 10 (sodium/bile acid cotransporter), member 1 | 7955 | ZDB-GENE-041001-190 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC10 family of sodium-bile acid co-transporters / Sodium/bile acid cotransporter
protein / Transporter / SLC superfamily of solute carriers / SLC10 family of sodium-bile acid co-transporters / Sodium/bile acid cotransporter
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.