🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

KCNJ10

DescriçãoATP-sensitive inward rectifier potassium channel 10

Gene and Protein Information

Gene ID3766
Uniprot Accession IDs P78508 A3KME7 Q5VUT9 Q8N4I7 Q92808
Ensembl ID ENSP00000357068
Symbol KIR1.2 KIR4.1 SESAME BIRK-10 KCNJ13-PEN
FamilyBelongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily.
Sequence
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Mouse16513Kcnj10potassium inwardly-rectifying channel, subfamily J, member 1010090MGI:1194504Inparanoid, OMA, EggNOG
Rat29718Kcnj10potassium voltage-gated channel subfamily J member 1010116RGD:61822Inparanoid, OMA
Horse100058121KCNJ10potassium voltage-gated channel subfamily J member 109796VGNC:19284Inparanoid, OMA, EggNOG
Cow533343KCNJ10potassium voltage-gated channel subfamily J member 109913VGNC:30454Inparanoid, OMA, EggNOG
Opossum100023256KCNJ10potassium voltage-gated channel subfamily J member 1013616Inparanoid, OMA, EggNOG
Xenopus779765kcnj10potassium channel, inwardly rectifying subfamily J, member 108364XB-GENE-5777345Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    Inward rectifier-type potassium channel family    /    KCNJ10 subfamily    /    ATP-sensitive inward rectifier potassium channel 10

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.