MAPK13

DescriçãoMitogen-activated protein kinase 13

Gene and Protein Information

Gene ID5603
Uniprot Accession IDs O15264 O14739 O15124 Q5U4A5 Q6FI46 Q9UNU0 MAP kinase 13
Ensembl ID ENSP00000211287
Symbol PRKM13 SAPK4 SAPK4 PRKM13 MAPK 13 MAPK-13 p38delta
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp462644MAPK13mitogen-activated protein kinase 139598VGNC:7195Inparanoid, OMA, EggNOG
Macaque719085MAPK13mitogen-activated protein kinase 139544OMA, EggNOG
Mouse26415Mapk13mitogen-activated protein kinase 1310090MGI:1346864Inparanoid, OMA, EggNOG
Rat29513Mapk13mitogen activated protein kinase 1310116RGD:3045Inparanoid, OMA, EggNOG
Dog612821MAPK13mitogen-activated protein kinase 139615VGNC:42994Inparanoid, OMA
Cow535327MAPK13mitogen-activated protein kinase 139913VGNC:50213Inparanoid, OMA
Opossum100028821MAPK13mitogen-activated protein kinase 1313616Inparanoid, OMA
Anole lizard100567479mapk13mitogen-activated protein kinase 1328377Inparanoid, OMA
Xenopus100144715mapk13mitogen-activated protein kinase 138364XB-GENE-490713Inparanoid, OMA
Zebrafish100002318mapk13mitogen-activated protein kinase 137955ZDB-GENE-041111-17Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.