CPN1

DescriçãoCarboxypeptidase N catalytic chain

Gene and Protein Information

Gene ID1369
Uniprot Accession IDs P15169 B1AP59 CPN
Ensembl ID ENSP00000359446
Symbol ACBP CPN SCPN
FamilyBelongs to the peptidase M14 family.
Sequence
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque709434CPN1carboxypeptidase N subunit 19544OMA, EggNOG
Mouse93721Cpn1carboxypeptidase N, polypeptide 110090MGI:2135874Inparanoid, OMA, EggNOG
Rat365466Cpn1carboxypeptidase N subunit 110116RGD:70931Inparanoid, OMA, EggNOG
Dog477795CPN1carboxypeptidase N subunit 19615VGNC:39558Inparanoid, OMA, EggNOG
Horse100070412CPN1carboxypeptidase N subunit 19796VGNC:50662Inparanoid, OMA, EggNOG
Cow536753CPN1carboxypeptidase N subunit 19913VGNC:27656Inparanoid, OMA, EggNOG
Pig100157984CPN1carboxypeptidase N subunit 19823Inparanoid, OMA, EggNOG
Opossum100020383CPN1carboxypeptidase N subunit 113616Inparanoid, EggNOG
Chicken769143CPN1carboxypeptidase N subunit 19031CGNC:5352Inparanoid, OMA, EggNOG
Anole lizard100563397cpn1carboxypeptidase N subunit 128377Inparanoid, OMA, EggNOG
Xenopus550020cpn1carboxypeptidase N subunit 18364XB-GENE-967670Inparanoid, OMA, EggNOG
Zebrafish337172cpn1carboxypeptidase N, polypeptide 17955ZDB-GENE-030131-9116Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.