🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

CTSE

DescriçãoCathepsin E

Gene and Protein Information

Gene ID1510
Uniprot Accession IDs P14091 Q5TZ01 Q5TZ02 Q9NY58 Q9UCE3 Q9UCE4
Ensembl ID ENSP00000350911
Symbol CATE
FamilyBelongs to the peptidase A1 family.
Sequence
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp457677CTSEcathepsin E9598VGNC:514OMA, EggNOG
Macaque696202CTSEcathepsin E9544Inparanoid, OMA
Mouse13034Ctsecathepsin E10090MGI:107361Inparanoid, OMA, EggNOG
Rat25424Ctsecathepsin E10116RGD:2446Inparanoid, OMA, EggNOG
Dog488577CTSEcathepsin E9615VGNC:39710Inparanoid, OMA
Horse100055161CTSEcathepsin E9796VGNC:16950Inparanoid, OMA, EggNOG
Opossum100019361CTSEcathepsin E13616Inparanoid, OMA, EggNOG
Chicken771791CTSEcathepsin E9031CGNC:503Inparanoid, OMA
Anole lizard100561705ctsecathepsin E28377Inparanoid, OMA, EggNOG
Xenopus100145572ctsecathepsin E8364XB-GENE-947864Inparanoid, OMA
S.cerevisiae855949PEP4proteinase A4932S000006075OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.