CCNE2

DescriçãoG1/S-specific cyclin-E2

Gene and Protein Information

Gene ID9134
Uniprot Accession IDs O96020 O95439
Ensembl ID ENSP00000429089
Symbol CYCE2
FamilyBelongs to the cyclin family. Cyclin E subfamily.
Sequence
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp464292CCNE2cyclin E29598VGNC:905OMA, EggNOG
Macaque700382CCNE2cyclin E29544Inparanoid, OMA
Mouse12448Ccne2cyclin E210090MGI:1329034Inparanoid, OMA, EggNOG
Rat362485Ccne2cyclin E210116RGD:1307783Inparanoid, OMA, EggNOG
Dog487057CCNE2cyclin E29615VGNC:54109Inparanoid, OMA, EggNOG
Horse100055302CCNE2cyclin E29796VGNC:16212Inparanoid, OMA, EggNOG
Cow538436CCNE2cyclin E29913VGNC:26967Inparanoid, OMA, EggNOG
Pig100512048CCNE2cyclin E29823Inparanoid, OMA, EggNOG
Opossum100022654CCNE2cyclin E213616OMA, EggNOG
Platypus100075784CCNE2cyclin E29258Inparanoid, OMA, EggNOG
Anole lizard100563792ccne2cyclin E228377Inparanoid, OMA
Xenopus549021ccne2cyclin E28364XB-GENE-923043Inparanoid, OMA
Zebrafish415165ccne2cyclin E27955ZDB-GENE-030131-9689Inparanoid, OMA
C. elegans172399cye-1G1/S-specific cyclin-E6239Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    G1/S-specific cyclin-E2
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    G1/S-specific cyclin-E2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.