🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

DHRS1

DescriçãoDehydrogenase/reductase SDR family member 1

Gene and Protein Information

Gene ID115817
Uniprot Accession IDs Q96LJ7 D3DS71 Q8NDG3 Q96B59 Q96CQ5
Ensembl ID ENSP00000288111
Symbol SDR19C1 SDR19C1
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp452816DHRS1dehydrogenase/reductase 19598VGNC:12779OMA, EggNOG
Macaque715933DHRS1dehydrogenase/reductase 19544Inparanoid, OMA
Mouse52585Dhrs1dehydrogenase/reductase (SDR family) member 110090MGI:1196314Inparanoid, OMA, EggNOG
Rat290234Dhrs1dehydrogenase/reductase 110116RGD:1359172Inparanoid, OMA, EggNOG
DogDHRS1dehydrogenase/reductase 1 [Source:HGNC Symbol;Acc:HGNC:16445]9615OMA, EggNOG
Horse100051088DHRS1dehydrogenase/reductase 19796VGNC:17163Inparanoid, OMA, EggNOG
Cow528832DHRS1dehydrogenase/reductase 19913VGNC:28039Inparanoid, OMA, EggNOG
Pig100519262DHRS1dehydrogenase/reductase 19823OMA, EggNOG
Opossum100025314DHRS1dehydrogenase/reductase 113616Inparanoid, EggNOG
Anole lizard100555049dhrs1dehydrogenase/reductase 128377Inparanoid, OMA, EggNOG
Zebrafish368670dhrs1dehydrogenase/reductase (SDR family) member 17955ZDB-GENE-030616-591Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.