CD24

DescriçãoSignal transducer CD24

Gene and Protein Information

Gene ID100133941
Uniprot Accession IDs P25063 A0A087WYI6 B6EC88 Q16257 Q53XS0 R4I4T5
Ensembl ID ENSP00000483985
Symbol CD24A CD24A
FamilyBelongs to the CD24 family.
Sequence
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Mouse12484Cd24aCD24a antigen10090MGI:88323Inparanoid, OMA
Rat25145Cd24CD24 molecule10116RGD:2298Inparanoid, OMA
Pig100519934LOC100519934uncharacterized LOC1005199349823Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.