CDK17

DescriçãoCyclin-dependent kinase 17

Gene and Protein Information

Gene ID5128
Uniprot Accession IDs Q00537 A8K1U6 B2RCQ2 Q8NEB8
Ensembl ID ENSP00000261211
Symbol PCTAIRE2 PCTK2 PCTK2 PCTAIRE2
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp452146CDK17cyclin dependent kinase 179598VGNC:8363OMA, EggNOG
Macaque717183CDK17cyclin dependent kinase 179544Inparanoid, OMA, EggNOG
Mouse237459Cdk17cyclin-dependent kinase 1710090MGI:97517Inparanoid, OMA, EggNOG
Rat314743Cdk17cyclin-dependent kinase 1710116RGD:1565593Inparanoid, OMA, EggNOG
Horse100065667CDK17cyclin dependent kinase 179796VGNC:16343Inparanoid, OMA, EggNOG
Cow539655CDK17cyclin dependent kinase 179913VGNC:27120Inparanoid, OMA, EggNOG
Pig100622337CDK17cyclin dependent kinase 179823Inparanoid, OMA, EggNOG
Opossum100012745CDK17cyclin dependent kinase 1713616Inparanoid, OMA, EggNOG
PlatypusCDK17cyclin dependent kinase 17 [Source:HGNC Symbol;Acc:HGNC:8750]9258OMA, EggNOG
Chicken417920CDK17cyclin dependent kinase 179031CGNC:8707Inparanoid, OMA, EggNOG
Anole lizard100558014cdk17cyclin dependent kinase 1728377Inparanoid, OMA, EggNOG
Xenopus100101773cdk17cyclin-dependent kinase 178364XB-GENE-920552Inparanoid, OMA, EggNOG
Zebrafish798487cdk17cyclin-dependent kinase 177955ZDB-GENE-041210-15OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.