CYP46A1

DescriçãoCholesterol 24-hydroxylase

Gene and Protein Information

Gene ID10858
Uniprot Accession IDs Q9Y6A2 B4DHP8 E7EQG9 Q8N2B0 CH24H
Ensembl ID ENSP00000261835
Symbol CYP46 CP46 CYP46
FamilyBelongs to the cytochrome P450 family.
Sequence
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp453154CYP46A1cytochrome P450 family 46 subfamily A member 19598VGNC:7521OMA, EggNOG
Macaque705843LOC705843cholesterol 24-hydroxylase9544OMA, EggNOG
Mouse13116Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110090MGI:1341877Inparanoid, OMA, EggNOG
Rat362782Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110116RGD:1306605Inparanoid, OMA
Dog480432CYP46A1cytochrome P450 family 46 subfamily A member 19615VGNC:50360Inparanoid, OMA, EggNOG
Horse100051131LOC100051131cholesterol 24-hydroxylase9796OMA, EggNOG
CowCYP46A1cytochrome P450 family 46 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2641]9913OMA, EggNOG
Pig100512793LOC100512793cholesterol 24-hydroxylase9823Inparanoid, OMA, EggNOG
Chicken423450CYP46A1cytochrome P450 family 46 subfamily A member 19031CGNC:8476Inparanoid, OMA, EggNOG
Anole lizard100552607LOC100552607cholesterol 24-hydroxylase28377OMA, EggNOG
Anole lizard100552409LOC100552409cholesterol 24-hydroxylase28377Inparanoid, OMA
Xenopus613109mgc108213uncharacterized protein mgc1082138364XB-GENE-969052OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    Cholesterol 24-hydroxylase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    Cholesterol 24-hydroxylase

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.