🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Beta-defensin 4A |
|---|
Gene and Protein Information
| Gene ID | 100289462 |
|---|---|
| Uniprot Accession IDs | O15263 Q52LC0 |
| Ensembl ID | ENSP00000424598 |
| Symbol | DEFB102 DEFB2 DEFB4 DEFB4P |
| Family | Belongs to the beta-defensin family. LAP/TAP subfamily. |
| Sequence | MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Rat | 64389 | Defb4 | defensin beta 4 | 10116 | RGD:619944 | OMA, EggNOG |
| Rat | 641624 | Defb5 | defensin beta 5 | 10116 | RGD:1563630 | Inparanoid, OMA |
| Pig | 396819 | DEFB1 | defensin, beta 1 | 9823 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / defense/immunity protein / antibacterial response protein / Beta-defensin 4A
protein / defense/immunity protein / antibacterial response protein / Beta-defensin 4A
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.