EDN2

DescriçãoEndothelin-2

Gene and Protein Information

Gene ID1907
Uniprot Accession IDs P20800 Q5T1R3 ET-2
Ensembl ID ENSP00000361668
Symbol ET2 ET-2 PPET2
FamilyBelongs to the endothelin/sarafotoxin family.
Sequence
MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp469298EDN2endothelin 29598VGNC:527OMA, EggNOG
Macaque695960EDN2endothelin 29544Inparanoid, OMA, EggNOG
Mouse13615Edn2endothelin 210090MGI:95284Inparanoid, OMA, EggNOG
Rat24324Edn2endothelin 210116RGD:2533Inparanoid, OMA, EggNOG
Dog403508EDN2endothelin 29615VGNC:40200Inparanoid, OMA, EggNOG
HorseEDN2endothelin 2 [Source:HGNC Symbol;Acc:HGNC:3177]9796OMA, EggNOG
Cow319094EDN2endothelin 29913VGNC:28328Inparanoid, OMA, EggNOG
Opossum100032585EDN2endothelin 213616Inparanoid, OMA, EggNOG
Chicken419559EDN2endothelin 29031CGNC:421Inparanoid, OMA, EggNOG
Zebrafish569550edn2endothelin 27955ZDB-GENE-060503-774Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Endothelin-2
DTO Classes
protein    /    Signaling    /    Hormone    /    Endothelin-2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.