🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

QPCT

DescriçãoGlutaminyl-peptide cyclotransferase

Gene and Protein Information

Gene ID25797
Uniprot Accession IDs Q16769 Q16770 Q3KRG6 Q53TR4
Ensembl ID ENSP00000344829
Symbol QC GCT sQC
FamilyBelongs to the glutaminyl-peptide cyclotransferase family.
Sequence
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp744549QPCTglutaminyl-peptide cyclotransferase9598VGNC:377OMA, EggNOG
Macaque712233QPCTglutaminyl-peptide cyclotransferase9544Inparanoid, OMA, EggNOG
Mouse70536Qpctglutaminyl-peptide cyclotransferase (glutaminyl cyclase)10090MGI:1917786Inparanoid, OMA, EggNOG
Dog403861QPCTglutaminyl-peptide cyclotransferase9615VGNC:45233Inparanoid, OMA, EggNOG
Horse100070174QPCTglutaminyl-peptide cyclotransferase9796VGNC:22071Inparanoid, OMA, EggNOG
Cow281437QPCTglutaminyl-peptide cyclotransferase9913VGNC:33598Inparanoid, OMA, EggNOG
Pig397424QPCTglutaminyl-peptide cyclotransferase9823Inparanoid, OMA, EggNOG
Opossum100012208QPCTglutaminyl-peptide cyclotransferase13616Inparanoid, EggNOG
Platypus100077983QPCTglutaminyl-peptide cyclotransferase9258Inparanoid, OMA, EggNOG
Anole lizard100563262qpctglutaminyl-peptide cyclotransferase28377Inparanoid, OMA, EggNOG
Xenopus549999qpctglutaminyl-peptide cyclotransferase8364XB-GENE-953343Inparanoid, OMA, EggNOG
Zebrafish795685qpctglutaminyl-peptide cyclotransferase7955ZDB-GENE-130827-1OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.