🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

HCRTR1

DescriçãoOrexin receptor type 1

Gene and Protein Information

Gene ID3061
Uniprot Accession IDs O43613 A8K3A6 Q9HBV6 Ox-1-R
Ensembl ID ENSP00000384387
Symbol OX1R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp469261HCRTR1hypocretin receptor 19598VGNC:8049OMA, EggNOG
Macaque705914HCRTR1hypocretin receptor 19544Inparanoid, OMA, EggNOG
Mouse230777Hcrtr1hypocretin (orexin) receptor 110090MGI:2385650Inparanoid, OMA, EggNOG
Rat25593Hcrtr1hypocretin receptor 110116RGD:2787Inparanoid, OMA, EggNOG
Dog100855896HCRTR1hypocretin receptor 19615VGNC:41623Inparanoid, OMA, EggNOG
Horse100056164HCRTR1hypocretin receptor 19796VGNC:18714Inparanoid, OMA
Cow282248HCRTR1hypocretin receptor 19913VGNC:29781Inparanoid, OMA, EggNOG
Pig387287HCRTR1hypocretin receptor 19823OMA, EggNOG
Platypus100075542HCRTR1hypocretin receptor 19258Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Orexin receptor type 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Orexin receptor type 1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.