🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PFN1

DescriçãoProfilin-1

Gene and Protein Information

Gene ID5216
Uniprot Accession IDs P07737 Q53Y44
Ensembl ID ENSP00000225655
Symbol ALS18
FamilyBelongs to the profilin family.
Sequence
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp748477PFN1profilin 19598VGNC:9511OMA, EggNOG
Macaque710753PFN1profilin 19544Inparanoid, OMA, EggNOG
Mouse18643Pfn1profilin 110090MGI:97549Inparanoid, OMA, EggNOG
Rat64303Pfn1profilin 110116RGD:621825Inparanoid, OMA, EggNOG
Dog607397PFN1profilin 19615VGNC:53432Inparanoid, OMA, EggNOG
Horse100061295PFN1profilin 19796OMA, EggNOG
Cow513895PFN1profilin 19913OMA, EggNOG
Pig100512494PFN1profilin 19823Inparanoid, EggNOG
Opossum100016522PFN1profilin 113616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.