🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SNRPB2

DescriçãoU2 small nuclear ribonucleoprotein B''

Gene and Protein Information

Gene ID6629
Uniprot Accession IDs P08579 B2R7J3 D3DW21 Q9UJD4 U2 snRNP B''
Ensembl ID ENSP00000246071
Symbol Msl1 U2B''
FamilyBelongs to the RRM U1 A/B'' family.
Sequence
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp458105SNRPB2small nuclear ribonucleoprotein polypeptide B29598VGNC:9995OMA, EggNOG
Mouse20639Snrpb2U2 small nuclear ribonucleoprotein B10090MGI:104805OMA, EggNOG
Rat362223Snrpb2small nuclear ribonucleoprotein polypeptide B210116RGD:1310194OMA, EggNOG
Dog477148SNRPB2small nuclear ribonucleoprotein polypeptide B29615OMA, EggNOG
Horse100050830SNRPB2small nuclear ribonucleoprotein polypeptide B29796VGNC:23396OMA, EggNOG
Cow767873SNRPB2small nuclear ribonucleoprotein polypeptide B29913VGNC:35077OMA, EggNOG
Platypus100078690SNRPB2small nuclear ribonucleoprotein polypeptide B29258OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    U2 small nuclear ribonucleoprotein B''
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    U2 small nuclear ribonucleoprotein B''

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.