🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SSTR2

DescriçãoSomatostatin receptor type 2

Gene and Protein Information

Gene ID6752
Uniprot Accession IDs P30874 A8K3Y0 B2R9P7 Q4VBP0 Q96GE0 Q96TF2 Q9BWH1 SS-2-R
Ensembl ID ENSP00000350198
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Macaque695526SSTR2somatostatin receptor 29544Inparanoid, OMA, EggNOG
Mouse20606Sstr2somatostatin receptor 210090MGI:98328Inparanoid, OMA, EggNOG
Rat54305Sstr2somatostatin receptor 210116RGD:3763Inparanoid, OMA, EggNOG
Dog403472SSTR2somatostatin receptor 29615VGNC:46844Inparanoid, OMA, EggNOG
Horse100052744SSTR2somatostatin receptor 29796VGNC:23621Inparanoid, OMA, EggNOG
Cow282083SSTR2somatostatin receptor 29913VGNC:35326Inparanoid, OMA, EggNOG
PigSSTR2somatostatin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11331]9823Inparanoid, OMA, EggNOG
Opossum100028527SSTR2somatostatin receptor 213616Inparanoid, OMA, EggNOG
Platypus100090283SSTR2somatostatin receptor 29258Inparanoid, OMA, EggNOG
Anole lizard100563000sstr2somatostatin receptor 228377Inparanoid, OMA
Xenopus100496382sstr2somatostatin receptor 28364XB-GENE-953419Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Somatostatin receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Somatostatin receptor type 2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.