🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

VHL

Descriçãovon Hippel-Lindau disease tumor suppressor

Gene and Protein Information

Gene ID7428
Uniprot Accession IDs P40337 B2RE45 Q13599 Q6PDA9
Ensembl ID ENSP00000256474
Symbol RCA1 VHL1 pVHL HRCA1
FamilyBelongs to the VHL family.
Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp749769VHLvon Hippel-Lindau tumor suppressor9598VGNC:48915Inparanoid, OMA
Mouse22346Vhlvon Hippel-Lindau tumor suppressor10090MGI:103223Inparanoid, OMA, EggNOG
Rat24874Vhlvon Hippel-Lindau tumor suppressor10116RGD:3960Inparanoid, OMA, EggNOG
Cow540957VHLvon Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase9913Inparanoid, OMA, EggNOG
Pig100739306VHLvon Hippel-Lindau tumor suppressor9823OMA, EggNOG
Chicken416117VHLvon Hippel-Lindau tumor suppressor9031CGNC:50168Inparanoid, OMA
Anole lizard100560920vhlvon Hippel-Lindau tumor suppressor28377OMA, EggNOG
Xenopus549121vhlvon Hippel-Lindau tumor suppressor8364XB-GENE-493997Inparanoid, OMA, EggNOG
Zebrafish791202vhlvon Hippel-Lindau tumor suppressor7955ZDB-GENE-070112-1042Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.