🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

FSHB

DescriçãoFollitropin subunit beta

Gene and Protein Information

Gene ID2488
Uniprot Accession IDs P01225 A2TF08 A5JVV3 Q14D61
Ensembl ID ENSP00000416606
Symbol HH24
FamilyBelongs to the glycoprotein hormones subunit beta family.
Sequence
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp736618FSHBfollicle stimulating hormone subunit beta9598VGNC:6558Inparanoid, OMA, EggNOG
Mouse14308Fshbfollicle stimulating hormone beta10090MGI:95582Inparanoid, OMA, EggNOG
Rat25447Fshbfollicle stimulating hormone subunit beta10116RGD:2630Inparanoid, OMA, EggNOG
Dog485428FSHBfollicle stimulating hormone subunit beta9615VGNC:40996Inparanoid, OMA, EggNOG
Horse100033829FSHBfollicle stimulating hormone beta subunit9796Inparanoid, OMA, EggNOG
Cow281171FSHBfollicle stimulating hormone beta subunit9913Inparanoid, OMA, EggNOG
Pig396895FSHBfollicle stimulating hormone beta subunit9823Inparanoid, OMA, EggNOG
Opossum554190FSHBfollicle stimulating hormone beta subunit13616Inparanoid, OMA, EggNOG
Platypus100073363FSHBfollicle stimulating hormone beta subunit9258Inparanoid, OMA, EggNOG
Chicken374108FSHBfollicle stimulating hormone beta subunit9031CGNC:9209OMA, EggNOG
Anole lizard100568157fshbfollicle stimulating hormone beta subunit28377Inparanoid, OMA, EggNOG
Xenopus100495812fshbfollicle stimulating hormone subunit beta8364XB-GENE-484695Inparanoid, OMA, EggNOG
Zebrafish402919fshbfollicle stimulating hormone subunit beta7955ZDB-GENE-040806-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Follitropin subunit beta
DTO Classes
protein    /    Signaling    /    Hormone    /    Follitropin subunit beta

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.