🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

FGF5

DescriçãoFibroblast growth factor 5

Gene and Protein Information

Gene ID2250
Uniprot Accession IDs P12034 B2R554 O75846 Q3Y8M3 Q8NF90 FGF-5
Ensembl ID ENSP00000311697
Symbol HBGF-5 TCMGLY Smag-82
FamilyBelongs to the heparin-binding growth factors family.
Sequence
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
ChimpFGF5fibroblast growth factor 5 [Source:HGNC Symbol;Acc:HGNC:3683]9598OMA, EggNOG
Mouse14176Fgf5fibroblast growth factor 510090MGI:95519Inparanoid, OMA, EggNOG
Rat60662Fgf5fibroblast growth factor 510116RGD:620129Inparanoid, OMA, EggNOG
Dog608459FGF5fibroblast growth factor 59615VGNC:40851Inparanoid, OMA, EggNOG
Horse100060219FGF5fibroblast growth factor 59796VGNC:18018Inparanoid, OMA, EggNOG
Cow536771FGF5fibroblast growth factor 59913VGNC:28980Inparanoid, OMA, EggNOG
Opossum100014690FGF5fibroblast growth factor 513616Inparanoid, OMA, EggNOG
Chicken770457FGF5fibroblast growth factor 59031CGNC:8278Inparanoid, OMA
Anole lizardFGF5fibroblast growth factor 5 [Source:HGNC Symbol;Acc:HGNC:3683]28377Inparanoid, OMA, EggNOG
Xenopus100486176fgf5fibroblast growth factor 58364XB-GENE-482346Inparanoid, OMA, EggNOG
Zebrafish494454fgf5fibroblast growth factor 57955ZDB-GENE-050201-6Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Fibroblast growth factor 5
DTO Classes
protein    /    Signaling    /    Growth factor    /    Fibroblast growth factor 5

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.