🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

HMOX1

DescriçãoHeme oxygenase 1

Gene and Protein Information

Gene ID3162
Uniprot Accession IDs P09601 HO-1
Ensembl ID ENSP00000216117
Symbol HO HO1 HO-1 HSP32 HMOX1D bK286B10
FamilyBelongs to the heme oxygenase family.
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp470195HMOX1heme oxygenase 19598VGNC:5270OMA, EggNOG
Macaque719266HMOX1heme oxygenase 19544Inparanoid, OMA
Mouse15368Hmox1heme oxygenase 110090MGI:96163Inparanoid, OMA, EggNOG
Rat24451Hmox1heme oxygenase 110116RGD:2806Inparanoid, OMA, EggNOG
Dog442987HMOX1heme oxygenase 19615VGNC:41719Inparanoid, OMA, EggNOG
Horse100069058HMOX1heme oxygenase 19796VGNC:18814Inparanoid, OMA, EggNOG
Cow513221HMOX1heme oxygenase 19913VGNC:29885Inparanoid, OMA, EggNOG
Opossum100030714LOC100030714heme oxygenase 1-like13616OMA, EggNOG
PlatypusHMOX1heme oxygenase 1 [Source:HGNC Symbol;Acc:HGNC:5013]9258OMA, EggNOG
Chicken396287HMOX1heme oxygenase 19031CGNC:49737Inparanoid, OMA, EggNOG
Anole lizard100555210hmox1heme oxygenase 128377Inparanoid, OMA, EggNOG
Xenopus100488303hmox1heme oxygenase 18364XB-GENE-1002243Inparanoid, OMA, EggNOG
Zebrafish791518hmox1aheme oxygenase 1a7955ZDB-GENE-030131-3102OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.