🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

FLOT2

DescriçãoFlotillin-2

Gene and Protein Information

Gene ID2319
Uniprot Accession IDs Q14254
Ensembl ID ENSP00000378368
Symbol ESA1 M17S1 ESA ECS1 ESA1 ECS-1 M17S1
FamilyBelongs to the band 7/mec-2 family. Flotillin subfamily.
Sequence
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp454537FLOT2flotillin 29598VGNC:9433OMA, EggNOG
Macaque716527FLOT2flotillin 29544Inparanoid, OMA, EggNOG
Mouse14252Flot2flotillin 210090MGI:103309Inparanoid, OMA, EggNOG
Rat83764Flot2flotillin 210116RGD:70993Inparanoid, OMA
Horse100072090FLOT2flotillin 29796VGNC:18064Inparanoid, OMA, EggNOG
Cow615679FLOT2flotillin 29913VGNC:29037Inparanoid, OMA, EggNOG
Pig100518752FLOT2flotillin 29823OMA, EggNOG
Opossum100025079FLOT2flotillin 213616Inparanoid, OMA, EggNOG
Anole lizard100563055flot2flotillin 228377Inparanoid, OMA, EggNOG
Xenopus496443flot2flotillin 28364XB-GENE-5910825Inparanoid, OMA, EggNOG
Zebrafish245698flot2aflotillin 2a7955ZDB-GENE-020430-3Inparanoid, OMA
Zebrafish393612flot2bflotillin 2b7955ZDB-GENE-040426-1368OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.