🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | IgG receptor FcRn large subunit p51 |
|---|
Gene and Protein Information
| Gene ID | 2217 |
|---|---|
| Uniprot Accession IDs | P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn |
| Ensembl ID | ENSP00000221466 |
| Symbol | FCRN FCRN alpha-chain |
| Family | Belongs to the immunoglobulin superfamily. |
| Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456208 | FCGRT | Fc fragment of IgG receptor and transporter | 9598 | VGNC:7558 | Inparanoid, OMA, EggNOG |
| Macaque | 718859 | FCGRT | Fc fragment of IgG receptor and transporter | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14132 | Fcgrt | Fc receptor, IgG, alpha chain transporter | 10090 | MGI:103017 | Inparanoid, OMA, EggNOG |
| Rat | 29558 | Fcgrt | Fc fragment of IgG receptor and transporter | 10116 | RGD:61811 | Inparanoid, OMA, EggNOG |
| Dog | 476414 | FCGRT | Fc fragment of IgG receptor and transporter | 9615 | VGNC:40803 | Inparanoid, OMA, EggNOG |
| Horse | 100147583 | FCGRT | Fc fragment of IgG receptor and transporter | 9796 | VGNC:17976 | Inparanoid, OMA, EggNOG |
| Cow | 338062 | FCGRT | Fc fragment of IgG receptor and transporter | 9913 | VGNC:28934 | Inparanoid, OMA, EggNOG |
| Pig | 397399 | FCGRT | Fc fragment of IgG receptor and transporter | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.