🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

IDI1

DescriçãoIsopentenyl-diphosphate Delta-isomerase 1

Gene and Protein Information

Gene ID3422
Uniprot Accession IDs Q13907 B4E155 Q32Q13 Q53GQ6 Q86U81 Q8WUX8 Q96IZ4 Q9BQ74
Ensembl ID ENSP00000370748
Symbol IPP1 IPPI1
FamilyBelongs to the IPP isomerase type 1 family.
Sequence
MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp104008078IDI1isopentenyl-diphosphate delta isomerase 19598VGNC:12346OMA, EggNOG
Macaque710052IDI1isopentenyl-diphosphate delta isomerase 19544Inparanoid, OMA, EggNOG
Mouse319554Idi1isopentenyl-diphosphate delta isomerase10090MGI:2442264Inparanoid, OMA, EggNOG
Rat89784Idi1isopentenyl-diphosphate delta isomerase 110116RGD:621835Inparanoid, OMA, EggNOG
Cow514293IDI1isopentenyl-diphosphate delta isomerase 19913Inparanoid, OMA, EggNOG
OpossumIDI1isopentenyl-diphosphate delta isomerase 1 [Source:HGNC Symbol;Acc:HGNC:5387]13616Inparanoid, OMA, EggNOG
Chicken420459IDI1isopentenyl-diphosphate delta isomerase 19031CGNC:51263Inparanoid, OMA, EggNOG
Anole lizard100559198LOC100559198isopentenyl-diphosphate Delta-isomerase 128377OMA, EggNOG
Xenopus496783idi1isopentenyl-diphosphate delta isomerase 18364XB-GENE-492551Inparanoid, OMA, EggNOG
Zebrafish553513idi1isopentenyl-diphosphate delta isomerase 17955ZDB-GENE-050913-44Inparanoid, OMA, EggNOG
S.cerevisiae855986IDI1isopentenyl-diphosphate delta-isomerase IDI14932S000006038OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.