🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SERPINB8

DescriçãoSerpin B8

Gene and Protein Information

Gene ID5271
Uniprot Accession IDs P50452 B4DTW2 Q7Z2V6 Q8N178
Ensembl ID ENSP00000381072
Symbol PI8 PI8 CAP2 PI-8 PSS5 C18orf53
FamilyBelongs to the serpin family. Ov-serpin subfamily.
Sequence
MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp107969517SERPINB8serpin family B member 89598VGNC:9947OMA, EggNOG
Macaque100424017LOC100424017serpin B89544OMA, EggNOG
Mouse20725Serpinb8serine (or cysteine) peptidase inhibitor, clade B, member 810090MGI:894657Inparanoid, OMA, EggNOG
Rat288937Serpinb8serpin family B member 810116RGD:1309833Inparanoid, OMA, EggNOG
Dog607205SERPINB8serpin family B member 89615VGNC:53976Inparanoid, OMA
Horse100051655SERPINB8serpin family B member 89796VGNC:22852Inparanoid, OMA
Cow513825SERPINB8serpin peptidase inhibitor, clade B (ovalbumin), member 89913Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Serpin B8
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Serpin B8

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.